PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_30688.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 248aa    MW: 26561.2 Da    PI: 9.0643
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_30688.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof79.63.5e-251412363
                   zf-Dof 23 nyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                             nysl+qPryfCk C+ryWt+GG+lrn+P+Ggg rknk+sss
  Rsa1.0_30688.1_g00001.1  1 NYSLTQPRYFCKDCKRYWTQGGSLRNIPIGGGIRKNKRSSS 41
                             9************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-15138IPR003851Zinc finger, Dof-type
PfamPF027011.7E-19138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088419.498138IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
NYSLTQPRYF CKDCKRYWTQ GGSLRNIPIG GGIRKNKRSS SSSSSNSNSS SSSKKTLFVD  60
NKTPPPLQQQ LNLKTAENNH VAGAAKVQEL AFSRGLGNAH EAKDLNSAFS QGFGIGHHHH  120
QSIPEFLQVA PSSALVSTSS ALELLGISNS FATSSNSRPA FVTYPNVHDS SVYTAASPGF  180
GLSYPQFQEF MRPPLGFSLD GGDPLRQEEG SSGTDIGRPL LPFESLKLHV SSSSTNSGGA  240
NGNDHERE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0848981e-88AY084898.1 Arabidopsis thaliana clone 120488 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608859.11e-119PREDICTED: dof zinc finger protein DOF1.8 isoform X1
RefseqXP_013608860.11e-119PREDICTED: dof zinc finger protein DOF1.8 isoform X2
SwissprotQ84JQ84e-99DOF18_ARATH; Dof zinc finger protein DOF1.8
TrEMBLA0A0D3E4731e-119A0A0D3E473_BRAOL; Uncharacterized protein
STRINGBra027722.1-P1e-117(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149321720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64620.13e-98Dof family protein